Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Anti-HIV Fab G3-519, (mouse), kappa L chain [63654] (1 PDB entry) |
Domain d1il1a2: 1il1 A:122-221 [62540] Other proteins in same PDB: d1il1a1, d1il1b1 |
PDB Entry: 1il1 (more details), 2.2 Å
SCOP Domain Sequences for d1il1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il1a2 b.1.1.2 (A:122-221) Immunoglobulin (constant domains of L and H chains) {Anti-HIV Fab G3-519, (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d1il1a2: