SCOPe 2.01: Domain d1il1a1: 1il1 A:3-121

Lineage for d1il1a1 (1il1 A:3-121)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d1il1a1: 1il1 A:3-121 [62539]
   Other proteins in same PDB: d1il1a2, d1il1b1, d1il1b2
   part of anti-HIV Fab G3-519

Details for d1il1a1

PDB Entry: 1il1, 2.2 Å

PDB Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody

PDB Compounds: (A:) monoclonal antibody G3-519 (heavy chain)

SCOPe Domain Sequences for d1il1a1:

Sequence; same for both SEQRES and ATOM records:

>d1il1a1 b.1.1.1 (A:3-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qlqqsgaelvrsgasvklscatsdfnikdyyihwvrqrpeqglewigwldpengdtesap
kfqgkatmtadtssntaylqlssltseasavyycnaisttrdyyaldywgqgtsvtvss

Timeline for d1il1a1:

• d1il1a1 first appeared in SCOP 1.57
  
• d1il1a1 appears in SCOP 1.75
  
• d1il1a1 appears in SCOPe 2.02
  
• d1il1a1 appears in the current release, SCOPe 2.08