SCOP 1.59: Domain d1il1a1: 1il1 A:3-121

Lineage for d1il1a1 (1il1 A:3-121)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anti-HIV Fab G3-519, (mouse), kappa L chain [63642] (1 PDB entry)

8. Domain d1il1a1: 1il1 A:3-121 [62539]
   Other proteins in same PDB: d1il1a2, d1il1b2

Details for d1il1a1

PDB Entry: 1il1, 2.2 Å

PDB Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody

SCOP Domain Sequences for d1il1a1:

Sequence; same for both SEQRES and ATOM records:

>d1il1a1 b.1.1.1 (A:3-121) Immunoglobulin (variable domains of L and H chains) {Anti-HIV Fab G3-519, (mouse), kappa L chain}
qlqqsgaelvrsgasvklscatsdfnikdyyihwvrqrpeqglewigwldpengdtesap
kfqgkatmtadtssntaylqlssltseasavyycnaisttrdyyaldywgqgtsvtvss

Timeline for d1il1a1:

• d1il1a1 first appeared in SCOP 1.57
  
• d1il1a1 appears in SCOP 1.61
  
• d1il1a1 appears in the current release, SCOPe 2.08