Lineage for d1ikxa2 (1ikx A:1-429)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055706Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1055707Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1055873Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1055874Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1055877Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (126 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1055942Domain d1ikxa2: 1ikx A:1-429 [62534]
    Other proteins in same PDB: d1ikxa1
    complexed with pnu; mutant

Details for d1ikxa2

PDB Entry: 1ikx (more details), 2.8 Å

PDB Description: k103n mutant hiv-1 reverse transcriptase in complex with the inhibitor pnu142721
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1ikxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikxa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1ikxa2:

Click to download the PDB-style file with coordinates for d1ikxa2.
(The format of our PDB-style files is described here.)

Timeline for d1ikxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ikxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ikxb_