Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries) Uniprot P01130 272-353 |
Domain d1ijqb2: 1ijq B:643-692 [62509] Other proteins in same PDB: d1ijqa1, d1ijqb1 |
PDB Entry: 1ijq (more details), 1.5 Å
SCOPe Domain Sequences for d1ijqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijqb2 g.3.11.1 (B:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} vnwcerttlsnggcqylclpapqinphspkftcacpdgmllardmrsclt
Timeline for d1ijqb2: