Lineage for d1ijqb2 (1ijq B:643-692)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2582960Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 2582961Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 2582963Domain d1ijqb2: 1ijq B:643-692 [62509]
    Other proteins in same PDB: d1ijqa1, d1ijqb1

Details for d1ijqb2

PDB Entry: 1ijq (more details), 1.5 Å

PDB Description: crystal structure of the ldl receptor ywtd-egf domain pair
PDB Compounds: (B:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1ijqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijqb2 g.3.11.1 (B:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
vnwcerttlsnggcqylclpapqinphspkftcacpdgmllardmrsclt

SCOPe Domain Coordinates for d1ijqb2:

Click to download the PDB-style file with coordinates for d1ijqb2.
(The format of our PDB-style files is described here.)

Timeline for d1ijqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ijqb1