Class b: All beta proteins [48724] (149 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins) |
Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (4 PDB entries) |
Domain d1ijfa2: 1ijf A:335-441 [62490] Other proteins in same PDB: d1ijfa1, d1ijfa3, d1ijfb_ complexed with gdp, mg |
PDB Entry: 1ijf (more details), 3 Å
SCOP Domain Sequences for d1ijfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijfa2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk
Timeline for d1ijfa2: