Lineage for d1ijfa1 (1ijf A:241-334)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60087Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 60088Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 60089Protein Elongation factor eEF-1alpha, domain 2 [50454] (1 species)
  7. 60090Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (4 PDB entries)
  8. 60094Domain d1ijfa1: 1ijf A:241-334 [62489]
    Other proteins in same PDB: d1ijfa2, d1ijfa3, d1ijfb_

Details for d1ijfa1

PDB Entry: 1ijf (more details), 3 Å

PDB Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex

SCOP Domain Sequences for d1ijfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijfa1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

SCOP Domain Coordinates for d1ijfa1:

Click to download the PDB-style file with coordinates for d1ijfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ijfa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ijfb_