Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.12: eEF-1beta-like [54984] (1 family) |
Family d.58.12.1: eEF-1beta-like [54985] (2 proteins) |
Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (4 PDB entries) |
Domain d1ijeb_: 1ije B: [62488] Other proteins in same PDB: d1ijea1, d1ijea2, d1ijea3 complexed with gdp |
PDB Entry: 1ije (more details), 2.4 Å
SCOP Domain Sequences for d1ijeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijeb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae)} paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved dkvslddlqqsieededhvqstdiaamqkl
Timeline for d1ijeb_: