Lineage for d1ijeb_ (1ije B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80517Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
  5. 80518Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)
  6. 80522Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 80523Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (4 PDB entries)
  8. 80526Domain d1ijeb_: 1ije B: [62488]
    Other proteins in same PDB: d1ijea1, d1ijea2, d1ijea3

Details for d1ijeb_

PDB Entry: 1ije (more details), 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex

SCOP Domain Sequences for d1ijeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijeb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae)}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

SCOP Domain Coordinates for d1ijeb_:

Click to download the PDB-style file with coordinates for d1ijeb_.
(The format of our PDB-style files is described here.)

Timeline for d1ijeb_: