SCOP 1.71: Domain d1ijea3: 1ije A:4-240

Lineage for d1ijea3 (1ije A:4-240)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (4 PDB entries)

8. Domain d1ijea3: 1ije A:4-240 [62487]
   Other proteins in same PDB: d1ijea1, d1ijea2, d1ijeb_
   complexed with gdp

Details for d1ijea3

PDB Entry: 1ije, 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex

SCOP Domain Sequences for d1ijea3:

Sequence; same for both SEQRES and ATOM records:

>d1ijea3 c.37.1.8 (A:4-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae)}
ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

Timeline for d1ijea3:

• d1ijea3 first appeared in SCOP 1.57
  
• d1ijea3 appears in SCOP 1.69
  
• d1ijea3 appears in SCOP 1.73
  
• d1ijea3 appears in the current release, SCOPe 2.08