| Class b: All beta proteins [48724] (144 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins) |
| Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (4 PDB entries) |
| Domain d1ijea2: 1ije A:335-441 [62486] Other proteins in same PDB: d1ijea1, d1ijea3, d1ijeb_ |
PDB Entry: 1ije (more details), 2.4 Å
SCOP Domain Sequences for d1ijea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijea2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk
Timeline for d1ijea2: