SCOP 1.69: Domain d1ijea1: 1ije A:241-334

Lineage for d1ijea1 (1ije A:241-334)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (8 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (4 PDB entries)

8. Domain d1ijea1: 1ije A:241-334 [62485]
   Other proteins in same PDB: d1ijea2, d1ijea3, d1ijeb_

Details for d1ijea1

PDB Entry: 1ije, 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex

SCOP Domain Sequences for d1ijea1:

Sequence; same for both SEQRES and ATOM records:

>d1ijea1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

Timeline for d1ijea1:

• d1ijea1 first appeared in SCOP 1.57
  
• d1ijea1 appears in SCOP 1.67
  
• d1ijea1 appears in SCOP 1.71
  
• d1ijea1 appears in the current release, SCOPe 2.08