| Class b: All beta proteins [48724] (141 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (2 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (6 proteins) |
| Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species) eukaryotic and archaeal homologue of EF-Tu |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (4 PDB entries) |
| Domain d1ijea1: 1ije A:241-334 [62485] Other proteins in same PDB: d1ijea2, d1ijea3, d1ijeb_ complexed with gdp |
PDB Entry: 1ije (more details), 2.4 Å
SCOP Domain Sequences for d1ijea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijea1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg
Timeline for d1ijea1: