Lineage for d1ijea1 (1ije A:241-334)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375649Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 375660Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 375661Family b.43.3.1: Elongation factors [50448] (6 proteins)
  6. 375667Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 375671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (4 PDB entries)
  8. 375674Domain d1ijea1: 1ije A:241-334 [62485]
    Other proteins in same PDB: d1ijea2, d1ijea3, d1ijeb_
    complexed with gdp

Details for d1ijea1

PDB Entry: 1ije (more details), 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex

SCOP Domain Sequences for d1ijea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijea1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

SCOP Domain Coordinates for d1ijea1:

Click to download the PDB-style file with coordinates for d1ijea1.
(The format of our PDB-style files is described here.)

Timeline for d1ijea1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ijeb_