Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (22 proteins) |
Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries) |
Domain d1ij9a2: 1ij9 A:1-90 [62483] Other proteins in same PDB: d1ij9a1 |
PDB Entry: 1ij9 (more details), 3 Å
SCOP Domain Sequences for d1ij9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ij9a2 b.1.1.4 (A:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)} fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp vsfgnehsylctatcesrklekgiqveiys
Timeline for d1ij9a2: