SCOPe 2.08: Domain d1ij9a2: 1ij9 A:1-90

Lineage for d1ij9a2 (1ij9 A:1-90)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries)

8. Domain d1ij9a2: 1ij9 A:1-90 [62483]
   Other proteins in same PDB: d1ij9a1
   D1

Details for d1ij9a2

PDB Entry: 1ij9, 3 Å

PDB Description: Highly Hydrated Human VCAM-1 Fragment

PDB Compounds: (A:) vascular cell adhesion protein 1

SCOPe Domain Sequences for d1ij9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ij9a2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

Timeline for d1ij9a2:

• d1ij9a2 first appeared in SCOP 1.57
  
• d1ij9a2 appears in SCOPe 2.07