Lineage for d1ij9a1 (1ij9 A:91-196)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290164Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 290216Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)
  7. 290217Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)
  8. 290222Domain d1ij9a1: 1ij9 A:91-196 [62482]
    Other proteins in same PDB: d1ij9a2

Details for d1ij9a1

PDB Entry: 1ij9 (more details), 3 Å

PDB Description: Highly Hydrated Human VCAM-1 Fragment

SCOP Domain Sequences for d1ij9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ij9a1 b.1.1.3 (A:91-196) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvy

SCOP Domain Coordinates for d1ij9a1:

Click to download the PDB-style file with coordinates for d1ij9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ij9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ij9a2