SCOP 1.67: Domain d1iixc2: 1iix C:87-171

Lineage for d1iixc2 (1iix C:87-171)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)

8. Domain d1iixc2: 1iix C:87-171 [62467]
   Other proteins in same PDB: d1iixa1, d1iixa2, d1iixb1, d1iixb2
   complexed with fuc, man, nag

Details for d1iixc2

PDB Entry: 1iix, 3.5 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)

SCOP Domain Sequences for d1iixc2:

Sequence; same for both SEQRES and ATOM records:

>d1iixc2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

Timeline for d1iixc2:

• d1iixc2 first appeared in SCOP 1.57
  
• d1iixc2 appears in SCOP 1.65
  
• d1iixc2 appears in SCOP 1.69
  
• d1iixc2 last appears in SCOP 1.71