Lineage for d1iixc2 (1iix C:87-171)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54288Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 54297Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
  8. 54305Domain d1iixc2: 1iix C:87-171 [62467]
    Other proteins in same PDB: d1iixa1, d1iixa2, d1iixb1, d1iixb2

Details for d1iixc2

PDB Entry: 1iix (more details), 3.5 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)

SCOP Domain Sequences for d1iixc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iixc2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

SCOP Domain Coordinates for d1iixc2:

Click to download the PDB-style file with coordinates for d1iixc2.
(The format of our PDB-style files is described here.)

Timeline for d1iixc2: