SCOP 1.71: Domain d1iixa1: 1iix A:235-341

Lineage for d1iixa1 (1iix A:235-341)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)

8. Domain d1iixa1: 1iix A:235-341 [62462]
   Other proteins in same PDB: d1iixa2, d1iixb2, d1iixc1, d1iixc2

Details for d1iixa1

PDB Entry: 1iix, 3.5 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)

SCOP Domain Sequences for d1iixa1:

Sequence; same for both SEQRES and ATOM records:

>d1iixa1 b.1.1.2 (A:235-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq
qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1iixa1:

• d1iixa1 first appeared in SCOP 1.57
  
• d1iixa1 appears in SCOP 1.69
  
• d1iixa1 does not appear in SCOP 1.73