Lineage for d1iisb2 (1iis B:342-443)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549641Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 549644Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)
  8. 549667Domain d1iisb2: 1iis B:342-443 [62457]
    Other proteins in same PDB: d1iisa1, d1iisb1, d1iisc1, d1iisc2
    part of a Fc
    complexed with fuc, man, nag

Details for d1iisb2

PDB Entry: 1iis (more details), 3 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)

SCOP Domain Sequences for d1iisb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iisb2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1iisb2:

Click to download the PDB-style file with coordinates for d1iisb2.
(The format of our PDB-style files is described here.)

Timeline for d1iisb2: