SCOPe 2.08: Domain d1iilf2: 1iil F:251-361

Lineage for d1iilf2 (1iil F:251-361)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)

8. Domain d1iilf2: 1iil F:251-361 [62440]
   Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_
   mutant

Details for d1iilf2

PDB Entry: 1iil, 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

PDB Compounds: (F:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1iilf2:

Sequence, based on SEQRES records:

>d1iilf2 b.1.1.4 (F:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlp

Sequence, based on observed residues (ATOM records):

>d1iilf2 b.1.1.4 (F:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdk
eievlyirnvtfedageytclagnsigisfhsawltvlp

Timeline for d1iilf2:

• d1iilf2 first appeared in SCOP 1.57
  
• d1iilf2 appears in SCOPe 2.07