SCOPe 2.07: Domain d1ihob_: 1iho B:

Lineage for d1ihob_ (1iho B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Escherichia coli [TaxId:562] [63978] (1 PDB entry)

8. Domain d1ihob_: 1iho B: [62391]
   complexed with edo, trs

Details for d1ihob_

PDB Entry: 1iho, 1.7 Å

PDB Description: crystal apo-structure of pantothenate synthetase from e. coli

PDB Compounds: (B:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d1ihob_:

Sequence; same for both SEQRES and ATOM records:

>d1ihob_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]}
mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
ddiqirdadtllevsetskravilvaawlgdarlidnkmvel

Timeline for d1ihob_:

• d1ihob_ first appeared in SCOP 1.57
  
• d1ihob_ appears in SCOPe 2.06
  
• d1ihob_ appears in the current release, SCOPe 2.08