Lineage for d1ihob_ (1iho B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121076Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 121077Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 121173Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
  6. 121174Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (1 species)
  7. 121175Species Escherichia coli [TaxId:562] [63978] (1 PDB entry)
  8. 121177Domain d1ihob_: 1iho B: [62391]

Details for d1ihob_

PDB Entry: 1iho (more details), 1.7 Å

PDB Description: crystal apo-structure of pantothenate synthetase from e. coli

SCOP Domain Sequences for d1ihob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihob_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli}
mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
ddiqirdadtllevsetskravilvaawlgdarlidnkmvel

SCOP Domain Coordinates for d1ihob_:

Click to download the PDB-style file with coordinates for d1ihob_.
(The format of our PDB-style files is described here.)

Timeline for d1ihob_: