Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) |
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family |
Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (1 species) |
Species Escherichia coli [TaxId:562] [63978] (1 PDB entry) |
Domain d1ihoa_: 1iho A: [62390] |
PDB Entry: 1iho (more details), 1.7 Å
SCOP Domain Sequences for d1ihoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli} mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra ddiqirdadtllevsetskravilvaawlgdarlidnkmvel
Timeline for d1ihoa_: