Lineage for d1ihoa_ (1iho A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein) Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (1 species) Species Escherichia coli [TaxId:562] [63978] (1 PDB entry) 
Domain d1ihoa_: 1iho A: [62390]
Details for d1ihoa_
PDB Entry: 1iho (more details), 1.7 Å
PDB Description: crystal apo-structure of pantothenate synthetase from e. coli
SCOP Domain Sequences for d1ihoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli}
mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
ddiqirdadtllevsetskravilvaawlgdarlidnkmvel
SCOP Domain Coordinates for d1ihoa_:
Click to download the PDB-style file with coordinates for d1ihoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihoa_:
- d1ihoa_ first appeared in SCOP 1.57
- d1ihoa_ appears in SCOP 1.59
- d1ihoa_ appears in SCOP 1.63
- d1ihoa_ appears in the current release, SCOPe 2.08
View in 3D
