Lineage for d1ihoa_ (1iho A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178484Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 178485Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 178610Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
  6. 178611Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (1 species)
  7. 178612Species Escherichia coli [TaxId:562] [63978] (1 PDB entry)
  8. 178613Domain d1ihoa_: 1iho A: [62390]

Details for d1ihoa_

PDB Entry: 1iho (more details), 1.7 Å

PDB Description: crystal apo-structure of pantothenate synthetase from e. coli

SCOP Domain Sequences for d1ihoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli}
mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
ddiqirdadtllevsetskravilvaawlgdarlidnkmvel

SCOP Domain Coordinates for d1ihoa_:

Click to download the PDB-style file with coordinates for d1ihoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ihoa_: