Lineage for d1ih5a_ (1ih5 A:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267942Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 267943Superfamily f.19.1: Aquaporin-like [81338] (1 family) (S)
  5. 267944Family f.19.1.1: Aquaporin-like [56895] (2 proteins)
    duplication: consist of two similar structural parts
  6. 267945Protein Aquaporin-1 [56896] (2 species)
  7. 267948Species Human (Homo sapiens) [TaxId:9606] [56897] (3 PDB entries)
  8. 267950Domain d1ih5a_: 1ih5 A: [62374]

Details for d1ih5a_

PDB Entry: 1ih5 (more details), 3.7 Å

PDB Description: crystal structure of aquaporin-1

SCOP Domain Sequences for d1ih5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ih5a_ f.19.1.1 (A:) Aquaporin-1 {Human (Homo sapiens)}
lfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsvg
hisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrnd
ladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidytg
cginparsfgsavithnfsnhwifwvgpfiggalavliydfila

SCOP Domain Coordinates for d1ih5a_:

Click to download the PDB-style file with coordinates for d1ih5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ih5a_: