Lineage for d1ih5a_ (1ih5 A:)
- Root: SCOP 1.57
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (10 families) 
Family f.2.1.5: Aquaporin-like [56895] (2 proteins) 
Protein Aquaporin-1 [56896] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56897] (2 PDB entries) 
Domain d1ih5a_: 1ih5 A: [62374]
Details for d1ih5a_
PDB Entry: 1ih5 (more details), 3.7 Å
PDB Description: crystal structure of aquaporin-1
SCOP Domain Sequences for d1ih5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ih5a_ f.2.1.5 (A:) Aquaporin-1 {Human (Homo sapiens)}
lfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsvg
hisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrnd
ladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidytg
cginparsfgsavithnfsnhwifwvgpfiggalavliydfila
SCOP Domain Coordinates for d1ih5a_:
Click to download the PDB-style file with coordinates for d1ih5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ih5a_:
- d1ih5a_ is new in SCOP 1.57
- d1ih5a_ appears in SCOP 1.59
- d1ih5a_ appears in the current release, SCOPe 2.08
View in 3D