Lineage for d1ig9a1 (1ig9 A:1-375)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) 
Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species) Species Bacteriophage RB69 [TaxId:12353] [53127] (5 PDB entries) 
Domain d1ig9a1: 1ig9 A:1-375 [62367]
Other proteins in same PDB: d1ig9a2
Details for d1ig9a1
PDB Entry: 1ig9 (more details), 2.6 Å
PDB Description: structure of the replicating complex of a pol alpha family dna polymerase
SCOP Domain Sequences for d1ig9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig9a1 c.55.3.5 (A:1-375) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke
SCOP Domain Coordinates for d1ig9a1:
Click to download the PDB-style file with coordinates for d1ig9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ig9a1:
- d1ig9a1 is new in SCOP 1.57
- d1ig9a1 appears in SCOP 1.59
- d1ig9a1 appears in the current release, SCOPe 2.08
View in 3D
