Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) |
Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein) |
Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63865] (2 PDB entries) |
Domain d1ig3a1: 1ig3 A:179-263 [62358] Other proteins in same PDB: d1ig3a2, d1ig3a3, d1ig3b2 complexed with so4, vib |
PDB Entry: 1ig3 (more details), 1.9 Å
SCOPe Domain Sequences for d1ig3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig3a1 b.82.6.1 (A:179-263) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]} dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts ntydgsglvtvetdhpllwtmaiks
Timeline for d1ig3a1: