![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.4: SNARE-like [64356] (5 families) ![]() beta(2)-alpha-beta(3)-alpha(2) |
![]() | Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins) |
![]() | Protein Sec22b [64358] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64359] (1 PDB entry) |
![]() | Domain d1ifqb1: 1ifq B:2-127 [62351] Other proteins in same PDB: d1ifqa2, d1ifqb2 complexed with gol |
PDB Entry: 1ifq (more details), 2.4 Å
SCOPe Domain Sequences for d1ifqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifqb1 d.110.4.1 (B:2-127) Sec22b {Mouse (Mus musculus) [TaxId: 10090]} vlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamtf hyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiqk tkklyi
Timeline for d1ifqb1: