SCOPe 2.07: Domain d1iepb1: 1iep B:229-498

Lineage for d1iepb1 (1iep B:229-498)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries)

8. Domain d1iepb1: 1iep B:229-498 [62334]
   Other proteins in same PDB: d1iepa2, d1iepb2
   complexed with cl, sti

Details for d1iepb1

PDB Entry: 1iep, 2.1 Å

PDB Description: crystal structure of the c-abl kinase domain in complex with sti-571.

PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase abl

SCOPe Domain Sequences for d1iepb1:

Sequence; same for both SEQRES and ATOM records:

>d1iepb1 d.144.1.7 (B:229-498) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfq

Timeline for d1iepb1:

• d1iepb1 first appeared in SCOP 1.57, called d1iepb_
  
• d1iepb1 appears in SCOPe 2.06
  
• d1iepb1 appears in the current release, SCOPe 2.08