Lineage for d1iepb_ (1iep B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84533Family d.144.1.2: Tyrosine kinase [56150] (9 proteins)
  6. 84534Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
  7. 84535Species Mouse (Mus musculus) [TaxId:10090] [56167] (2 PDB entries)
  8. 84537Domain d1iepb_: 1iep B: [62334]

Details for d1iepb_

PDB Entry: 1iep (more details), 2.1 Å

PDB Description: crystal structure of the c-abl kinase domain in complex with sti-571.

SCOP Domain Sequences for d1iepb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iepb_ d.144.1.2 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
pekvyelmracwqwnpsdrpsfaeihqafetmfq

SCOP Domain Coordinates for d1iepb_:

Click to download the PDB-style file with coordinates for d1iepb_.
(The format of our PDB-style files is described here.)

Timeline for d1iepb_: