SCOPe 2.05: Domain d1ie3d1: 1ie3 D:1-145

Lineage for d1ie3d1 (1ie3 D:1-145)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Escherichia coli [TaxId:562] [51853] (4 PDB entries)

8. Domain d1ie3d1: 1ie3 D:1-145 [62310]
   Other proteins in same PDB: d1ie3a2, d1ie3b2, d1ie3c2, d1ie3d2
   complexed with nad, pyr

Details for d1ie3d1

PDB Entry: 1ie3, 2.5 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase

PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d1ie3d1:

Sequence; same for both SEQRES and ATOM records:

>d1ie3d1 c.2.1.5 (D:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

Timeline for d1ie3d1:

• d1ie3d1 first appeared in SCOP 1.57
  
• d1ie3d1 appears in SCOPe 2.04
  
• d1ie3d1 appears in SCOPe 2.06
  
• d1ie3d1 appears in the current release, SCOPe 2.08