Lineage for d1ie3a1 (1ie3 A:1-145)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66837Protein Malate dehydrogenase [51849] (7 species)
  7. 66842Species Escherichia coli [TaxId:562] [51853] (4 PDB entries)
  8. 66849Domain d1ie3a1: 1ie3 A:1-145 [62304]
    Other proteins in same PDB: d1ie3a2, d1ie3b2, d1ie3c2, d1ie3d2

Details for d1ie3a1

PDB Entry: 1ie3 (more details), 2.5 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase

SCOP Domain Sequences for d1ie3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie3a1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOP Domain Coordinates for d1ie3a1:

Click to download the PDB-style file with coordinates for d1ie3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ie3a1: