SCOP 1.65: Domain d1idrb_: 1idr B:

Lineage for d1idrb_ (1idr B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (5 species)

7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (1 PDB entry)

8. Domain d1idrb_: 1idr B: [62302]
   complexed with hem, oxy, po4

Details for d1idrb_

PDB Entry: 1idr, 1.9 Å

PDB Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis

SCOP Domain Sequences for d1idrb_:

Sequence; same for both SEQRES and ATOM records:

>d1idrb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt

Timeline for d1idrb_:

• d1idrb_ first appeared in SCOP 1.57
  
• d1idrb_ appears in SCOP 1.63
  
• d1idrb_ appears in SCOP 1.67
  
• d1idrb_ appears in the current release, SCOPe 2.08