SCOPe 2.07: Domain d1ic4h_: 1ic4 H:

Lineage for d1ic4h_ (1ic4 H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)

8. Domain d1ic4h_: 1ic4 H: [62251]
   Other proteins in same PDB: d1ic4l_, d1ic4y_
   part of Fv HyHEL-10
   mutant

Details for d1ic4h_

PDB Entry: 1ic4, 2.5 Å

PDB Description: crystal structure of hyhel-10 fv mutant(hd32a)-hen lysozyme complex

PDB Compounds: (H:) igg1 fab chain h

SCOPe Domain Sequences for d1ic4h_:

Sequence; same for both SEQRES and ATOM records:

>d1ic4h_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsaywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

Timeline for d1ic4h_:

• d1ic4h_ first appeared in SCOP 1.57
  
• d1ic4h_ appears in SCOPe 2.06
  
• d1ic4h_ appears in the current release, SCOPe 2.08