Lineage for d1ic4h_ (1ic4 H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219787Species Fab HyHEL-10 (mouse), kappa L chain [48788] (8 PDB entries)
  8. 219798Domain d1ic4h_: 1ic4 H: [62251]
    Other proteins in same PDB: d1ic4y_
    Fv fragment only
    mutant

Details for d1ic4h_

PDB Entry: 1ic4 (more details), 2.5 Å

PDB Description: crystal structure of hyhel-10 fv mutant(hd32a)-hen lysozyme complex

SCOP Domain Sequences for d1ic4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic4h_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
dvqlqesgpslvkpsqtlsltcsvtgdsitsaywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOP Domain Coordinates for d1ic4h_:

Click to download the PDB-style file with coordinates for d1ic4h_.
(The format of our PDB-style files is described here.)

Timeline for d1ic4h_: