Lineage for d1ibxa_ (1ibx A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1893877Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1893878Family d.15.2.1: CAD domain [54278] (3 proteins)
  6. 1893879Protein Caspase-activated DNase (CAD), DFF40, N-terminal domain [54281] (2 species)
  7. 1893880Species Human (Homo sapiens) [TaxId:9606] [64223] (1 PDB entry)
  8. 1893881Domain d1ibxa_: 1ibx A: [62231]
    Other proteins in same PDB: d1ibxb_

Details for d1ibxa_

PDB Entry: 1ibx (more details)

PDB Description: nmr structure of dff40 and dff45 n-terminal domain complex
PDB Compounds: (A:) DNA fragmentation factor 40

SCOPe Domain Sequences for d1ibxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibxa_ d.15.2.1 (A:) Caspase-activated DNase (CAD), DFF40, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mlqkpksvklralrsprkfgvagrscqevlrkgclrfqlpergsrlclyedgteltedyf
psvpdnaelvlltlgqawqgh

SCOPe Domain Coordinates for d1ibxa_:

Click to download the PDB-style file with coordinates for d1ibxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ibxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ibxb_