Lineage for d1ibmq_ (1ibm Q:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 206241Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 206242Protein 70S ribosome functional complex [58121] (2 species)
  7. 206273Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 206332Domain d1ibmq_: 1ibm Q: [62222]

Details for d1ibmq_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site

SCOP Domain Sequences for d1ibmq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibmq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1ibmq_:

Click to download the PDB-style file with coordinates for d1ibmq_.
(The format of our PDB-style files is described here.)

Timeline for d1ibmq_: