Lineage for d1ibmo_ (1ibm O:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268875Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2268941Domain d1ibmo_: 1ibm O: [62220]
    protein/RNA complex; complexed with mg, zn

Details for d1ibmo_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1ibmo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibmo_ i.1.1.1 (O:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1ibmo_:

Click to download the PDB-style file with coordinates for d1ibmo_.
(The format of our PDB-style files is described here.)

Timeline for d1ibmo_: