Lineage for d1ibmj_ (1ibm J:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. Protein 70S ribosome functional complex [58121] (2 species)
  7. Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. Domain d1ibmj_: 1ibm J: [62215]

Details for d1ibmj_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site

SCOP Domain Sequences for d1ibmj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibmj_ i.1.1.1 (J:) 70S ribosome functional complex {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1ibmj_ are not available.

Timeline for d1ibmj_: