Lineage for d1ibll_ (1ibl L:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1468440Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1468459Domain d1ibll_: 1ibl L: [62196]
    protein/RNA complex; complexed with mg, par, zn

Details for d1ibll_

PDB Entry: 1ibl (more details), 3.11 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1ibll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibll_ i.1.1.1 (L:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d1ibll_:

Click to download the PDB-style file with coordinates for d1ibll_.
(The format of our PDB-style files is described here.)

Timeline for d1ibll_: