SCOP 1.75: Domain d1ibli

Lineage for d1ibli_ (1ibl I:)

Root: SCOP 1.75
Class i: Low resolution protein structures [58117] (26 folds)
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
Family i.1.1.1: Ribosome complexes [58120] (1 protein)
Protein 70S ribosome functional complex [58121] (9 species)
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
Domain d1ibli_: 1ibl I: [62193]

Details for d1ibli_

PDB Entry: 1ibl (more details), 3.11 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin

PDB Compounds: (I:) 30S ribosomal protein S9

SCOP Domain Sequences for d1ibli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibli_ i.1.1.1 (I:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1ibli_:

Click to download the PDB-style file with coordinates for d1ibli_.
(The format of our PDB-style files is described here.)

Timeline for d1ibli_:

d1ibli_ first appeared in SCOP 1.57
d1ibli_ appears in SCOP 1.73
d1ibli_ appears in SCOPe 2.01
d1ibli_ appears in the current release, SCOPe 2.08