SCOP 1.61: Domain d1ibkr_: 1ibk R:

Lineage for d1ibkr_ (1ibk R:)

1. Root: SCOP 1.61

2. Class i: Low resolution protein structures [58117] (17 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)

8. Domain d1ibkr_: 1ibk R: [62181]

Details for d1ibkr_

PDB Entry: 1ibk, 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin

SCOP Domain Sequences for d1ibkr_:

Sequence; same for both SEQRES and ATOM records:

>d1ibkr_ i.1.1.1 (R:) 70S ribosome functional complex {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1ibkr_:

• d1ibkr_ first appeared in SCOP 1.57
  
• d1ibkr_ appears in SCOP 1.59
  
• d1ibkr_ appears in SCOP 1.63
  
• d1ibkr_ appears in the current release, SCOPe 2.08