| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (9 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
| Domain d1ibkg_: 1ibk G: [62170] |
PDB Entry: 1ibk (more details), 3.31 Å
SCOP Domain Sequences for d1ibkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibkg_ i.1.1.1 (G:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1ibkg_: