Lineage for d1ibba_ (1ibb A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55097Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 55181Species Photobacterium leiognathi [49337] (7 PDB entries)
  8. 55185Domain d1ibba_: 1ibb A: [62156]

Details for d1ibba_

PDB Entry: 1ibb (more details), 2.1 Å

PDB Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant w83f

SCOP Domain Sequences for d1ibba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibba_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi}
qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpftddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

SCOP Domain Coordinates for d1ibba_:

Click to download the PDB-style file with coordinates for d1ibba_.
(The format of our PDB-style files is described here.)

Timeline for d1ibba_: