Lineage for d1ib6d2 (1ib6 D:146-312)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85227Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 85228Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 85229Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 85285Protein Malate dehydrogenase [56329] (7 species)
  7. 85290Species Escherichia coli [TaxId:562] [56333] (4 PDB entries)
  8. 85296Domain d1ib6d2: 1ib6 D:146-312 [62153]
    Other proteins in same PDB: d1ib6a1, d1ib6b1, d1ib6c1, d1ib6d1

Details for d1ib6d2

PDB Entry: 1ib6 (more details), 2.1 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase

SCOP Domain Sequences for d1ib6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib6d2 d.162.1.1 (D:146-312) Malate dehydrogenase {Escherichia coli}
vttldiicsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk

SCOP Domain Coordinates for d1ib6d2:

Click to download the PDB-style file with coordinates for d1ib6d2.
(The format of our PDB-style files is described here.)

Timeline for d1ib6d2: