Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Escherichia coli [TaxId:562] [51853] (4 PDB entries) |
Domain d1ib6c1: 1ib6 C:1-145 [62150] Other proteins in same PDB: d1ib6a2, d1ib6b2, d1ib6c2, d1ib6d2 complexed with nad, so4 |
PDB Entry: 1ib6 (more details), 2.1 Å
SCOPe Domain Sequences for d1ib6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib6c1 c.2.1.5 (C:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp vnttvaiaaevlkkagvydknklfg
Timeline for d1ib6c1: