Lineage for d1ib6c1 (1ib6 C:1-145)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118753Protein Malate dehydrogenase [51849] (10 species)
  7. 118780Species Escherichia coli [TaxId:562] [51853] (4 PDB entries)
  8. 118785Domain d1ib6c1: 1ib6 C:1-145 [62150]
    Other proteins in same PDB: d1ib6a2, d1ib6b2, d1ib6c2, d1ib6d2

Details for d1ib6c1

PDB Entry: 1ib6 (more details), 2.1 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase

SCOP Domain Sequences for d1ib6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib6c1 c.2.1.5 (C:1-145) Malate dehydrogenase {Escherichia coli}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOP Domain Coordinates for d1ib6c1:

Click to download the PDB-style file with coordinates for d1ib6c1.
(The format of our PDB-style files is described here.)

Timeline for d1ib6c1: